PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013860m
Common NameCARUB_v10013860mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GRF
Protein Properties Length: 404aa    MW: 45718.9 Da    PI: 8.6348
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013860mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.43e-2481125145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++++k+CE+H+hrgr+r rks ++
  Carubv10013860m  81 DPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQ 125
                      79***************************************9875 PP

2QLQ64.13.5e-221651237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FT++Q+q+L++Q+l+yKy+++++PvPpeL++ i++
  Carubv10013860m 16 PFTPTQWQELEHQALIYKYMVSGVPVPPELIFSIRR 51
                     9*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.9E-141551IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-161650IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.9271651IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.29781125IPR014977WRC domain
PfamPF088791.9E-2082122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MMSLSGNSGR TIERPPFTPT QWQELEHQAL IYKYMVSGVP VPPELIFSIR RSLDSTLVSR  60
LLPHQSLGWG CYQMGFGRKP DPEPGRCRRT DGKKWRCSRE AYPDSKYCEK HMHRGRNRAR  120
KSLDQNQTTT PLTSPSLSFP NNNNPSPTLS SSSSSSSSTT TYSASSSSLD AYSNQNRFGV  180
GGSSSNTRGY FNSHSLDYPY PATSPKQQQQ QPLHHASALS LHQTTNPTSQ FNVLASATDN  240
KDFRYFQGIG ERIGVGERTF FPEASRSFQD SPYHHQQPLA TVMNDPYHHC STDQKIDHHH  300
TYSSSSSSQH LHHDHEQDNH HRQQQQQCFV LGADMFNKPT RSSVLANSSR QDQNQKEEEK  360
DSSESKKSLH HFFGEDWAQN KTSDSWLDLS SHSRLDTGNY CKR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1026380.0AY102638.1 Arabidopsis thaliana transcription activator (GRF5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297825.10.0hypothetical protein CARUB_v10013860mg
SwissprotQ8L8A60.0GRF5_ARATH; Growth-regulating factor 5
TrEMBLR0I2Z10.0R0I2Z1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__1504__AT3G13960.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45672651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.10.0growth-regulating factor 5